Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 7 - Jul 12
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Mycobacterium tuberculosis fbpB/Ag85B Protein, His TagProduct Specification Synonyms Diacylglycerol acyltransferase mycolyltransferase Ag85B, DGAT, 30 kDa extracellular protein, Acyl CoA: diacylglycerol acyltransferase, Antigen 85 complex B (85B; Ag85B), Extracellular alpha antigen, Fibronectin binding protein B (Fbps B), MT1934 Accession P9WQP0 Amino Acid Sequence Protein sequence (P9WQP0, Phe41 Gly325, with N His Tag)
Product Specification
| Synonyms | Diacylglycerol acyltransferase/mycolyltransferase Ag85B, DGAT, 30 kDa extracellular protein, Acyl-CoA:diacylglycerol acyltransferase, Antigen 85 complex B (85B; Ag85B), Extracellular alpha-antigen, Fibronectin-binding protein B (Fbps B), MT1934 |
| Accession | P9WQP0 |
| Amino Acid Sequence | Protein sequence (P9WQP0, Phe41-Gly325, with N-His Tag) FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 32.3 kDa Observed MW: 35-43 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Ag85B is a major secreted antigen and mycolyltransferase of the Mycobacterium tuberculosis complex. This multifunctional enzyme plays a central role in constructing the unique mycobacterial cell wall. As part of the Ag85 complex, it catalyzes the transfer of mycolic acids—long-chain fatty acids—onto the arabinogalactan-peptidoglycan matrix, forming the essential mycolyl-arabinogalactan-peptidoglycan complex (mAGP). This creates the robust, hydrophobic outer membrane critical for pathogenicity and antibiotic resistance. Due to its high immunogenicity, Ag85B is also a leading candidate antigen in several tuberculosis vaccine strategies.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy