SKU: 64692701640

Human GH, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 15 - Jul 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human GH, His tagProduct Specification Species Human Synonyms Somatotropin; Growth hormone 1; Pituitary growth hormone Accession P01241 Amino Acid Sequence Protein sequence(P01241, Phe27 Phe217, with C 10*His) MFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight

Product Specification


Species Human
Synonyms Somatotropin; Growth hormone 1; Pituitary growth hormone
Accession P01241
Amino Acid Sequence

Protein sequence(P01241, Phe27-Phe217, with C-10*His)
MFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 23.9kDa Actual: 24kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Growth hormone (GH) or somatotropin, also known as human growth hormone (hGH or HGH) in its human form, is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration in humans and other animals. It is thus important in human development. GH also stimulates production of IGF-1 and increases the concentration of glucose and free fatty acids. It is a type of mitogen which is specific only to the receptors on certain types of cells. GH is a 191-amino acid, single-chain polypeptide that is synthesized, stored and secreted by somatotropic cells within the lateral wings of the anterior pituitary gland.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 64692701640

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 1857 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nathan D.
Birmingham, US
★★★★★ 5
Morrison Finishing With Style!
Format: Hardcover
The exciting conclusion to Morrison's fantastic, fascinating, and F***ing awesome Batman and Robin run. Bringing together all of the pieces of his past stories to a head and blowing it all up in your face! Not only is the book amazing in the way it delivers a great pay off to a satisfying story it also offers an amazing ride on the way there. On top of all that there is some fantastic behind the scenes stuff in the deluxe edition that offers some in site into Grant Morrison's creative process, and the execution of ideas + this book has some great joker moments and also sets up Batman Inc with the conclusion of his Batman and robin story, along with the nice inclusion of "Batman the return" a nice one shot that sets things up for the future. All in all well worth the wait, and is a must have for anyone following Morrison's run on Batman.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2011
S
Verified Purchase
saintwalker
Chelsea, US
★★★★★ 4
Batman and Robin Will Never Die!!!!!!
Format: Hardcover
If you read Batman R.I.P. you saw those words shouted from the Dark Knight himself. This is the third volume of the popular Grant Morrison series Batman and Robin. This is also the conclusion of Grant's run on the book as well. We see a number of story lines finally reach their end. First thing first. I would recommend strongly that you purchase the first two volumes of this book. Just to give you a quick refresh this is not the Batman and Robin you are expecting. Richard Grayson is under the cowl, finally stepping in to the boots of his mentor. (Bruce was apparently murder by by Darkseid in Final Crisis.) The young lad who has taken the role of Robin is Damian Wayne. He is the son of Bruce Wayne and Talia al Ghul (daughter of Batman's nemesis Ra's al Ghul) . Let me say that this isn't your father's Batman and Robin. Well now that I think about it this isn't even my Batman and Robin. This is a Dynamic Duo for a new generation. Anyone who is familar with Dick Grayson either as Robin or Nightwing knows he is different from Batman. He is not the gloomy, dark and brooding character that Bruce is. Right away you will notice his Batman is different from his predecessor . (Heck, even Gordon and The Joker can tell). Dick's Batman may not be as dark as Bruce but he is not happy go lucky either. He has no problem opening a can of kick butt whenever it is needed. As for Damian this is a very different Robin as well. Robin was always light to Batman's darkness. The kid who says the one liners while Batman knock his foe unconscious. That is not the case here. Damian is dark, violent and a little of a brat most of time. Then again he was raised and trained by "The League of Assassins" since birth. I seriously doubt he has had the normal childhood others characters who wore the Robin mask did. Damian has no problem dishing out the pain either. Sometimes though he tends to dish out too much. In the past we seen him leave his opponents temporary cripple and with a concussion. This is the twist that I love about this book. The roles have been reversed. Batman is the lighter character and Robin is the dark one. What I also love about this book is we see the guy (Dick) who defined the sidekick role takes on a sidekick. Which is why we probably we see a lighter Batman. Dick is being the Batman he wanted. Bruce and Dick even though they were the original "Dynamic Duo" and define the hero sidekick role they still had their problems. It's great to see Dick become a father/big brother figure to Damian even if he is reluctant to it. This relationship is one of the best I have seen in comics for a long time. Now on to the story. As I said before the story "Batman must Die" brings to a close to Grants run on the book. I will not spoil anything but I will say it does not disappoint. We see Batman and Robin face what seems like impossible odds. A city in chaos and worst of all the Joker is in the middle. I will say one thing I love Grant's interpretation of the Joker and again like in "Batman R.I.P." he steals the show. I won't spoil too much but the Robin and Joker confrontation is great. (What happens when the Robin has the crowbar?) We also see you know who makes his return to Gotham as well. The big climatic fight scene is awesome. You see how much of a team that the current versions Batman and Robin have become. Speaking of which that is one of the biggest highlights in this book. We finally see these characters grow in to the new roles they have taken. When we first met Damian he was a brat who would not think twice about decapitating a criminal. I love watching him practicing restraint. This was the same character long ago who felt enemies should be dealt with no mercy. Now he is showing mercy. (Well some what) Despite what Damian has said he actually wants to change and be the hero that Dick and others believe he can be. I know some people might not like Damian because he is a brat and really obnoxious at times but I actually like him a lot. Damian is different from all the other Robins. Bruce trained Dick, Jason, Tim and even Stephanie the skills to be Robin and fight crime along side of him. Damian was thought to fight by assassins from birth. He has always had the skills. His path on being Robin is different than the others. He is being trained to be a hero. We finally see the hero he can be in this volume. In the first volume we saw Dick screaming to Damian about fighting as a team and working together. You almost had to wonder will this partnership even last? In this volume we actually see this Duo become Dynamic. We see Dick and Damian work as a team. We see Damian actually following orders. We actually see Dick and Damian become Batman and Robin. I didn't want to spoil much in my review because I didn't want to ruin a great story for any first time readers. Those who have already read this story know how it ends and where Grant will be taking the Batman Franchise in the future. I know sometimes Grant can go overboard and may lose many readers in a way too complex story but that is not the case here. I really hope Grant writes these characters again. Honestly its been a long time since I enjoyed a Batman book like this. I would recommend this book to any DC or Batman fan.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2011
R
Verified Purchase
Ryan C.
Bozeman, US
★★★★★ 5
The end to one of the most epic runs on ANY superhero character
Format: Hardcover
Way back when Grant Morrison first took over writing on Batman, you could begin to sense the epic storytelling approach he was going to have on this book. And boy did he ever. From way back then with introduction of Damian, to Bruce Wayne being stuck in time, a new dynamic duo in Dick Grayson as Batman and Damian as the new Robin, every area has been fun to read. This volume and The Return of Bruce Wayne (which should be read injunction with this book) mark a great exclamation point for Grant's run on these character. Yes I know, we now have Batman Incorporated. But as of this writing, Batman INC has been put on hiatus due to the New 52 being implemented at DC Comics. While difficult to follow without a flow chart, this book really culminated the past almost three years of stories that Grant has been building up. And all is done with such drama and action, your fingers can't wait to turn the page!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 9, 2011
G
Verified Purchase
Garrett Wroblewski
Grantham, US
★★★★★ 5
The New Era of Batman Begins NOW
Format: Hardcover
I just finished reading Batman and Robin: Batman and Robin Must Die- the deluxe edition by Grant Morrison. This book, collecting issues 13-16 of the series and the special Batman: The Return, is so good it almost makes up for the goofball s pectacle of Bruce Wayne dying and hurtling through time to fight sentient organic robots or something. I still don't get what the f*** was going on there. Not enough acid in the world... The entire city of Gotham made fiending addicts by a new airborne virus, the new Batman and Robin of Dick Grayson and Damien Wayne are overwhelmed by the scope of the problem. Throw in an allegedly reformed Joker masquerading as a detective, and a morbidly obese psychopath in a pig mask squealing with delight at his own torture and you have a dark return to form for the Bat-books which have been marred in self-indulgent existential nonsense for far too long. The art is lush and cinematic, each panel more gorgeous than the last. The highlight of the issue for any long-term Bat fan HAS to be the scene with the latest incantation of Robin locked in an interrogation room with the Joker, beating him within an inch of his life with a crowbar. Both an allusion to the Joker's murder of Jason Todd from back in the 80's and the classic interrogation scene from The Dark Knight, this entire scene hums with the fierce energy of live wires. Then Batman (Bruce Wayne... the "real" Batman) shows up and takes this series in an entirely new direction than has ever been attempted before. This isn't just some comic book, it is pop art of the finest caliber. Make sure to purchase the deluxe edition for delicious insights into the decisions made regarding characters and plots points, selections which were anything but arbitrary. Grade: A+
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 11, 2012
T
Verified Purchase
Torin McFarland
Alexandria, US
★★★★★ 5
Fantastic End to the Final Crisis Arc with Grant Morrison
Format: Paperback
Some of Morrison's best work, bar none. While The Return of Bruce Wayne in my opinion is the best of the Batman and Robin Volume 1-3 and Return of Bruce Wayne post-Final Crisis arc, this is also an excellent read / end to the Dick and Damian trilogy. The artwork is varied, eerie, phenomenal, though I recognize it is a love-it-or-hate-it style for some. Overall, I highly recommend this series, and this volume in particular is electrifying (ha!)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2022

recommand products